SCOP 1.65: Domain d1ezve2: 1ezv E:31-86

Lineage for d1ezve2 (1ezv E:31-86)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.12: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81502] (1 family)

5. Family f.23.12.1: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81501] (1 protein)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (4 PDB entries)

8. Domain d1ezve2: 1ezv E:31-86 [59549]
   Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
   complexed with fes, hem, sma, uq6

Details for d1ezve2

PDB Entry: 1ezv, 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezve2:

Sequence; same for both SEQRES and ATOM records:

>d1ezve2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae)}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

Timeline for d1ezve2:

• d1ezve2 first appeared in SCOP 1.57
  
• d1ezve2 appears in SCOP 1.63
  
• d1ezve2 appears in SCOP 1.67
  
• d1ezve2 appears in the current release, SCOPe 2.08