Lineage for d1ezvx_ (1ezv X:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287668Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (27 PDB entries)
  8. 287678Domain d1ezvx_: 1ezv X: [59554]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvy_
    part of Fv against Rieske protein from the yeast cytochrome bc1 complex
    complexed with fes, hem, sma, uq6

Details for d1ezvx_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvx_ b.1.1.1 (X:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

SCOP Domain Coordinates for d1ezvx_:

Click to download the PDB-style file with coordinates for d1ezvx_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvx_: