SCOP 1.63: Domain d1ezvc2: 1ezv C:262-385

Lineage for d1ezvc2 (1ezv C:262-385)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (1 protein)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (3 PDB entries)

8. Domain d1ezvc2: 1ezv C:262-385 [75833]
   Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
   complexed with fes, hem, sma, uq6

Details for d1ezvc2

PDB Entry: 1ezv, 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvc2:

Sequence; same for both SEQRES and ATOM records:

>d1ezvc2 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d1ezvc2:

• d1ezvc2 is new in SCOP 1.63
  
• d1ezvc2 appears in SCOP 1.65
  
• d1ezvc2 appears in the current release, SCOPe 2.08