Lineage for d1klgb1 (1klg B:93-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747492Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2747501Domain d1klgb1: 1klg B:93-190 [72716]
    Other proteins in same PDB: d1klga1, d1klga2, d1klgb2, d1klgd1, d1klgd2
    mutant

Details for d1klgb1

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1klgb1:

Sequence, based on SEQRES records: (download)

>d1klgb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1klgb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtf
qtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1klgb1:

Click to download the PDB-style file with coordinates for d1klgb1.
(The format of our PDB-style files is described here.)

Timeline for d1klgb1: