![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
![]() | Domain d1klgb1: 1klg B:93-190 [72716] Other proteins in same PDB: d1klga1, d1klga2, d1klgb2, d1klgd1, d1klgd2 mutant |
PDB Entry: 1klg (more details), 2.4 Å
SCOPe Domain Sequences for d1klgb1:
Sequence, based on SEQRES records: (download)
>d1klgb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d1klgb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtf qtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1klgb1:
![]() Domains from other chains: (mouse over for more information) d1klga1, d1klga2, d1klgd1, d1klgd2 |