Lineage for d1klgb1 (1klg B:93-190)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159093Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)
  8. 159097Domain d1klgb1: 1klg B:93-190 [72716]
    Other proteins in same PDB: d1klga2, d1klgb2, d1klgd1, d1klgd2

Details for d1klgb1

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klgb1:

Sequence, based on SEQRES records: (download)

>d1klgb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1klgb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtf
qtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1klgb1:

Click to download the PDB-style file with coordinates for d1klgb1.
(The format of our PDB-style files is described here.)

Timeline for d1klgb1: