![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
![]() | Domain d1bccb2: 1bcc B:236-439 [58949] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_ complexed with bog, fes, hem, pee, u10 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOPe Domain Sequences for d1bccb2:
Sequence, based on SEQRES records: (download)
>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl yqavakgvhnpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak kfvsrqksmaasgnlghtpfvdel
>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg htpfvdel
Timeline for d1bccb2: