SCOPe 2.05: Domain d1bcca2: 1bcc A:233-445

Lineage for d1bcca2 (1bcc A:233-445)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)

8. Domain d1bcca2: 1bcc A:233-445 [58947]
   Other proteins in same PDB: d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bcca2

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (A:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bcca2:

Sequence; same for both SEQRES and ATOM records:

>d1bcca2 d.185.1.1 (A:233-445) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kcrftgsqirhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsss
plasiavtnklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsises
evlrgknflrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcs
kyiydqcpavagpgpieqlpdynrirsgmfwlr

Timeline for d1bcca2:

• d1bcca2 first appeared in SCOP 1.57
  
• d1bcca2 appears in SCOPe 2.04
  
• d1bcca2 appears in SCOPe 2.06
  
• d1bcca2 appears in the current release, SCOPe 2.08