![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
![]() | Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries) |
![]() | Domain d1bccd3: 1bcc D:196-241 [43698] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_ complexed with bog, fes, hem, pee, u10 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOPe Domain Sequences for d1bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]} pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
Timeline for d1bccd3: