Lineage for d1bccd3 (1bcc D:196-241)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958008Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 1958009Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 1958010Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 1958022Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)
  8. 1958023Domain d1bccd3: 1bcc D:196-241 [43698]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bccd3

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1bccd3:

Click to download the PDB-style file with coordinates for d1bccd3.
(The format of our PDB-style files is described here.)

Timeline for d1bccd3: