Lineage for d1bccd2 (1bcc D:1-195)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720126Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1720127Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1720139Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)
  8. 1720140Domain d1bccd2: 1bcc D:1-195 [15959]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bccd2

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus) [TaxId: 9031]}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1bccd2:

Click to download the PDB-style file with coordinates for d1bccd2.
(The format of our PDB-style files is described here.)

Timeline for d1bccd2: