SCOPe 2.04: Domain d1bccb2: 1bcc B:236-439

Lineage for d1bccb2 (1bcc B:236-439)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)

8. Domain d1bccb2: 1bcc B:236-439 [58949]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bccb2

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (B:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccb2:

Sequence, based on SEQRES records:

>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl
yqavakgvhnpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne
nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak
kfvsrqksmaasgnlghtpfvdel

Sequence, based on observed residues (ATOM records):

>d1bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa
fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms
vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg
htpfvdel

Timeline for d1bccb2:

• d1bccb2 first appeared in SCOP 1.57
  
• d1bccb2 appears in SCOPe 2.03
  
• d1bccb2 appears in SCOPe 2.05
  
• d1bccb2 appears in the current release, SCOPe 2.08