Lineage for d7vz1a3 (7vz1 A:360-458)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708905Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 2708913Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 2708914Protein automated matches [254684] (5 species)
    not a true protein
  7. 3086126Species Sus scrofa [TaxId:9823] [422443] (3 PDB entries)
  8. 3087263Domain d7vz1a3: 7vz1 A:360-458 [423580]
    Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1e_, d7vz1g_, d7vz1q_
    automated match to d6zk913
    complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn

Details for d7vz1a3

PDB Entry: 7vz1 (more details), 2.5 Å

PDB Description: matrix arm of deactive state ci from q1-nadh dataset
PDB Compounds: (A:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d7vz1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vz1a3 a.29.12.0 (A:360-458) automated matches {Sus scrofa [TaxId: 9823]}
stdivkaiarliefykhescgqctpcregvdwmnkvmarfvkgdarpaeidslweiskqi
eghticalgdgaawpvqglirhfrpeleermqqfalqhq

SCOPe Domain Coordinates for d7vz1a3:

Click to download the PDB-style file with coordinates for d7vz1a3.
(The format of our PDB-style files is described here.)

Timeline for d7vz1a3:

  • d7vz1a3 is new in SCOPe 2.08-stable