Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
Family a.29.12.0: automated matches [254298] (1 protein) not a true family |
Protein automated matches [254684] (5 species) not a true protein |
Species Sus scrofa [TaxId:9823] [422443] (3 PDB entries) |
Domain d7vz1a3: 7vz1 A:360-458 [423580] Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1e_, d7vz1g_, d7vz1q_ automated match to d6zk913 complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn |
PDB Entry: 7vz1 (more details), 2.5 Å
SCOPe Domain Sequences for d7vz1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vz1a3 a.29.12.0 (A:360-458) automated matches {Sus scrofa [TaxId: 9823]} stdivkaiarliefykhescgqctpcregvdwmnkvmarfvkgdarpaeidslweiskqi eghticalgdgaawpvqglirhfrpeleermqqfalqhq
Timeline for d7vz1a3: