Lineage for d7vz1g_ (7vz1 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 3086120Species Sus scrofa [TaxId:9823] [422437] (4 PDB entries)
  8. 3087285Domain d7vz1g_: 7vz1 G: [423602]
    Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1a3, d7vz1e_, d7vz1q_
    automated match to d7b93u_
    complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn

Details for d7vz1g_

PDB Entry: 7vz1 (more details), 2.5 Å

PDB Description: matrix arm of deactive state ci from q1-nadh dataset
PDB Compounds: (G:) Acyl carrier protein

SCOPe Domain Sequences for d7vz1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vz1g_ a.28.1.0 (G:) automated matches {Sus scrofa [TaxId: 9823]}
sdappltleaikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
eipdidaeklmcpqeivdyiadkkdvye

SCOPe Domain Coordinates for d7vz1g_:

Click to download the PDB-style file with coordinates for d7vz1g_.
(The format of our PDB-style files is described here.)

Timeline for d7vz1g_:

  • d7vz1g_ is new in SCOPe 2.08-stable