Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (29 species) not a true protein |
Species Sus scrofa [TaxId:9823] [422437] (4 PDB entries) |
Domain d7vz1g_: 7vz1 G: [423602] Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1a3, d7vz1e_, d7vz1q_ automated match to d7b93u_ complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn |
PDB Entry: 7vz1 (more details), 2.5 Å
SCOPe Domain Sequences for d7vz1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vz1g_ a.28.1.0 (G:) automated matches {Sus scrofa [TaxId: 9823]} sdappltleaikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf eipdidaeklmcpqeivdyiadkkdvye
Timeline for d7vz1g_: