Lineage for d7vz1e_ (7vz1 E:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029490Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily)
    three-helix bundle, with long extended loops that interact with other subunits
  4. 3029491Superfamily f.71.1: LYR protein-like [418775] (2 families) (S)
  5. 3029492Family f.71.1.1: LYR proteins [418863] (4 proteins)
  6. 3029513Protein automated matches [419269] (4 species)
    not a true protein
  7. 3086118Species Sus scrofa [TaxId:9823] [422435] (3 PDB entries)
  8. 3087264Domain d7vz1e_: 7vz1 E: [423581]
    Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1a3, d7vz1g_, d7vz1q_
    automated match to d6zk9g_
    complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn

Details for d7vz1e_

PDB Entry: 7vz1 (more details), 2.5 Å

PDB Description: matrix arm of deactive state ci from q1-nadh dataset
PDB Compounds: (E:) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

SCOPe Domain Sequences for d7vz1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vz1e_ f.71.1.1 (E:) automated matches {Sus scrofa [TaxId: 9823]}
gtsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfmknahv
tdprvvdllvikgkmeleetinvwkqrthimrffheteaprptdflskfyvghdp

SCOPe Domain Coordinates for d7vz1e_:

Click to download the PDB-style file with coordinates for d7vz1e_.
(The format of our PDB-style files is described here.)

Timeline for d7vz1e_:

  • d7vz1e_ is new in SCOPe 2.08-stable