Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily) three-helix bundle, with long extended loops that interact with other subunits |
Superfamily f.71.1: LYR protein-like [418775] (2 families) |
Family f.71.1.1: LYR proteins [418863] (4 proteins) |
Protein automated matches [419269] (4 species) not a true protein |
Species Sus scrofa [TaxId:9823] [422435] (3 PDB entries) |
Domain d7vz1e_: 7vz1 E: [423581] Other proteins in same PDB: d7vz1a1, d7vz1a2, d7vz1a3, d7vz1g_, d7vz1q_ automated match to d6zk9g_ complexed with 2mr, 8q1, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, zn |
PDB Entry: 7vz1 (more details), 2.5 Å
SCOPe Domain Sequences for d7vz1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vz1e_ f.71.1.1 (E:) automated matches {Sus scrofa [TaxId: 9823]} gtsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfmknahv tdprvvdllvikgkmeleetinvwkqrthimrffheteaprptdflskfyvghdp
Timeline for d7vz1e_: