Lineage for d7fh3a1 (7fh3 A:223-379)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824139Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)
  8. 3085727Domain d7fh3a1: 7fh3 A:223-379 [422044]
    Other proteins in same PDB: d7fh3a2, d7fh3a3, d7fh3b2, d7fh3b3
    automated match to d1x6va1
    complexed with bgc, so4

Details for d7fh3a1

PDB Entry: 7fh3 (more details), 1.8 Å

PDB Description: crystal structure of the atp sulfurylase domain of human papss2
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2

SCOPe Domain Sequences for d7fh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fh3a1 b.122.1.0 (A:223-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dihelfvpenkldhvraeaetlpslsitkldlqwvqvlsegwatplkgfmrekeylqvmh
fdtllddgvinmsipivlpvsaedktrlegcskfvlahggrrvailrdaefyehrkeerc
srvwgttctkhphikmvmesgdwlvggdlqvlekirw

SCOPe Domain Coordinates for d7fh3a1:

Click to download the PDB-style file with coordinates for d7fh3a1.
(The format of our PDB-style files is described here.)

Timeline for d7fh3a1:

  • d7fh3a1 is new in SCOPe 2.08-stable