Lineage for d7fh3a2 (7fh3 A:380-612)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860766Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2860802Protein automated matches [226985] (2 species)
    not a true protein
  7. 3085567Species Homo sapiens [TaxId:9606] [421884] (2 PDB entries)
  8. 3085728Domain d7fh3a2: 7fh3 A:380-612 [422045]
    Other proteins in same PDB: d7fh3a1, d7fh3a3, d7fh3b1, d7fh3b3
    automated match to d1x6va2
    complexed with bgc, so4

Details for d7fh3a2

PDB Entry: 7fh3 (more details), 1.8 Å

PDB Description: crystal structure of the atp sulfurylase domain of human papss2
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2

SCOPe Domain Sequences for d7fh3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fh3a2 c.26.1.5 (A:380-612) automated matches {Homo sapiens [TaxId: 9606]}
ndgldqyrltplelkqkckemnadavfafqlrnpvhnghallmqdtrrrllergykhpvl
llhplggwtkdddvpldwrmkqhaavleegvldpkstivaifpspmlyagptevqwhcrs
rmiaganfyivgrdpagmphpetkkdlyepthggkvlsmapgltsveiipfrvaaynkak
kamdfydparhnefdfisgtrmrklaregenppdgfmapkawkvltdyyrsle

SCOPe Domain Coordinates for d7fh3a2:

Click to download the PDB-style file with coordinates for d7fh3a2.
(The format of our PDB-style files is described here.)

Timeline for d7fh3a2:

  • d7fh3a2 is new in SCOPe 2.08-stable