![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins) automatically mapped to Pfam PF01747 |
![]() | Protein automated matches [226985] (2 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [421884] (2 PDB entries) |
![]() | Domain d7fh3a2: 7fh3 A:380-612 [422045] Other proteins in same PDB: d7fh3a1, d7fh3a3, d7fh3b1, d7fh3b3 automated match to d1x6va2 complexed with bgc, so4 |
PDB Entry: 7fh3 (more details), 1.8 Å
SCOPe Domain Sequences for d7fh3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7fh3a2 c.26.1.5 (A:380-612) automated matches {Homo sapiens [TaxId: 9606]} ndgldqyrltplelkqkckemnadavfafqlrnpvhnghallmqdtrrrllergykhpvl llhplggwtkdddvpldwrmkqhaavleegvldpkstivaifpspmlyagptevqwhcrs rmiaganfyivgrdpagmphpetkkdlyepthggkvlsmapgltsveiipfrvaaynkak kamdfydparhnefdfisgtrmrklaregenppdgfmapkawkvltdyyrsle
Timeline for d7fh3a2: