![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain automatically mapped to Pfam PF14306 |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141702] (3 PDB entries) Uniprot O43252 229-389 |
![]() | Domain d1x6va1: 1x6v A:229-389 [121755] Other proteins in same PDB: d1x6va2, d1x6va3, d1x6va4, d1x6vb2, d1x6vb3 complexed with adp, cl |
PDB Entry: 1x6v (more details), 1.75 Å
SCOPe Domain Sequences for d1x6va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereyl qclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrk eercarqwgttcknhpyikmvmeqgdwliggdlqvldrvyw
Timeline for d1x6va1: