![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
![]() | Protein automated matches [191089] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries) |
![]() | Domain d7fh3b1: 7fh3 B:223-379 [421910] Other proteins in same PDB: d7fh3a2, d7fh3a3, d7fh3b2, d7fh3b3 automated match to d1x6va1 complexed with bgc, so4 |
PDB Entry: 7fh3 (more details), 1.8 Å
SCOPe Domain Sequences for d7fh3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7fh3b1 b.122.1.0 (B:223-379) automated matches {Human (Homo sapiens) [TaxId: 9606]} dihelfvpenkldhvraeaetlpslsitkldlqwvqvlsegwatplkgfmrekeylqvmh fdtllddgvinmsipivlpvsaedktrlegcskfvlahggrrvailrdaefyehrkeerc srvwgttctkhphikmvmesgdwlvggdlqvlekirw
Timeline for d7fh3b1: