SCOPe 2.08: Domain d7fhaa1: 7fha A:223-379

Lineage for d7fhaa1 (7fha A:223-379)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)

8. Domain d7fhaa1: 7fha A:223-379 [421883]
   Other proteins in same PDB: d7fhaa2, d7fhab2, d7fhab3
   automated match to d1x6va1
   complexed with adx, bgc, k, so4

Details for d7fhaa1

PDB Entry: 7fha, 2 Å

PDB Description: crystal structure of the atp sulfurylase domain of human papss2 in complex with aps

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2

SCOPe Domain Sequences for d7fhaa1:

Sequence; same for both SEQRES and ATOM records:

>d7fhaa1 b.122.1.0 (A:223-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dihelfvpenkldhvraeaetlpslsitkldlqwvqvlsegwatplkgfmrekeylqvmh
fdtllddgvinmsipivlpvsaedktrlegcskfvlahggrrvailrdaefyehrkeerc
srvwgttctkhphikmvmesgdwlvggdlqvlekirw

Timeline for d7fhaa1:

• d7fhaa1 is new in SCOPe 2.08-stable