SCOPe 2.08: Domain d7fhaa2: 7fha A:380-612

Lineage for d7fhaa2 (7fha A:380-612)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
   automatically mapped to Pfam PF01747

6. Protein automated matches [226985] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [421884] (2 PDB entries)

8. Domain d7fhaa2: 7fha A:380-612 [421885]
   Other proteins in same PDB: d7fhaa1, d7fhab1, d7fhab3
   automated match to d1x6va2
   complexed with adx, bgc, k, so4

Details for d7fhaa2

PDB Entry: 7fha, 2 Å

PDB Description: crystal structure of the atp sulfurylase domain of human papss2 in complex with aps

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2

SCOPe Domain Sequences for d7fhaa2:

Sequence; same for both SEQRES and ATOM records:

>d7fhaa2 c.26.1.5 (A:380-612) automated matches {Homo sapiens [TaxId: 9606]}
ndgldqyrltplelkqkckemnadavfafqlrnpvhnghallmqdtrrrllergykhpvl
llhplggwtkdddvpldwrmkqhaavleegvldpkstivaifpspmlyagptevqwhcrs
rmiaganfyivgrdpagmphpetkkdlyepthggkvlsmapgltsveiipfrvaaynkak
kamdfydparhnefdfisgtrmrklaregenppdgfmapkawkvltdyyrsle

Timeline for d7fhaa2:

• d7fhaa2 is new in SCOPe 2.08-stable