Lineage for d7fhab1 (7fha B:223-379)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824139Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)
  8. 3085615Domain d7fhab1: 7fha B:223-379 [421932]
    Other proteins in same PDB: d7fhaa2, d7fhab2, d7fhab3
    automated match to d1x6va1
    complexed with adx, bgc, k, so4

Details for d7fhab1

PDB Entry: 7fha (more details), 2 Å

PDB Description: crystal structure of the atp sulfurylase domain of human papss2 in complex with aps
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2

SCOPe Domain Sequences for d7fhab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fhab1 b.122.1.0 (B:223-379) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dihelfvpenkldhvraeaetlpslsitkldlqwvqvlsegwatplkgfmrekeylqvmh
fdtllddgvinmsipivlpvsaedktrlegcskfvlahggrrvailrdaefyehrkeerc
srvwgttctkhphikmvmesgdwlvggdlqvlekirw

SCOPe Domain Coordinates for d7fhab1:

Click to download the PDB-style file with coordinates for d7fhab1.
(The format of our PDB-style files is described here.)

Timeline for d7fhab1:

  • d7fhab1 is new in SCOPe 2.08-stable