Lineage for d5fb8b_ (5fb8 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760170Domain d5fb8b_: 5fb8 B: [410065]
    Other proteins in same PDB: d5fb8a2, d5fb8c_
    automated match to d6shgh_
    complexed with edo, so4, trs

Details for d5fb8b_

PDB Entry: 5fb8 (more details), 2.07 Å

PDB Description: structure of interleukin-16 bound to the 14.1 antibody
PDB Compounds: (B:) Anti-IL-16 antibody 14.1 Fab domain Heavy Chain

SCOPe Domain Sequences for d5fb8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fb8b_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewiglinpynsgtny
nqkfkdkatlivdkssntaymellsltsedsavyycarsdyydsthyfdywgqgttltvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d5fb8b_:

Click to download the PDB-style file with coordinates for d5fb8b_.
(The format of our PDB-style files is described here.)

Timeline for d5fb8b_:

  • d5fb8b_ is new in SCOPe 2.08-stable