Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries) |
Domain d5fb8c_: 5fb8 C: [318134] Other proteins in same PDB: d5fb8a1, d5fb8a2, d5fb8b_ automated match to d2awxb_ complexed with edo, so4, trs |
PDB Entry: 5fb8 (more details), 2.07 Å
SCOPe Domain Sequences for d5fb8c_:
Sequence, based on SEQRES records: (download)
>d5fb8c_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eatvctvtlekmsaglgfsleggkgslhgdkpltinrifkgaaseqsetvqpgdeilqlg gtamqgltrfeawniikalpdgpvtivirrks
>d5fb8c_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eatvctvtlekmsaglgfsleggkgslhgdkpltinrifktvqpgdeilqlggtamqglt rfeawniikalpdgpvtivirrks
Timeline for d5fb8c_: