Lineage for d5fb8a2 (5fb8 A:136-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752724Domain d5fb8a2: 5fb8 A:136-243 [318132]
    Other proteins in same PDB: d5fb8a1, d5fb8b_, d5fb8c_
    automated match to d1dn0a2
    complexed with edo, so4, trs

Details for d5fb8a2

PDB Entry: 5fb8 (more details), 2.07 Å

PDB Description: structure of interleukin-16 bound to the 14.1 antibody
PDB Compounds: (A:) Anti-IL-16 antibody 14.1 Fab domain Kappa Chain

SCOPe Domain Sequences for d5fb8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fb8a2 b.1.1.2 (A:136-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5fb8a2:

Click to download the PDB-style file with coordinates for d5fb8a2.
(The format of our PDB-style files is described here.)

Timeline for d5fb8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fb8a1