Lineage for d7lj5d2 (7lj5 D:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752662Domain d7lj5d2: 7lj5 D:107-211 [405482]
    Other proteins in same PDB: d7lj5d1, d7lj5e_, d7lj5f1, d7lj5g_
    automated match to d5vzrb2
    complexed with ca, k; mutant

Details for d7lj5d2

PDB Entry: 7lj5 (more details), 2.26 Å

PDB Description: human traak k+ channel fhieg mutant a198e in a k+ bound conductive conformation
PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d7lj5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lj5d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d7lj5d2:

Click to download the PDB-style file with coordinates for d7lj5d2.
(The format of our PDB-style files is described here.)

Timeline for d7lj5d2: