SCOPe 2.07: Domain d7lj5d2: 7lj5 D:107-211

Lineage for d7lj5d2 (7lj5 D:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d7lj5d2: 7lj5 D:107-211 [405482]
   Other proteins in same PDB: d7lj5d1, d7lj5f1
   automated match to d5vzrb2
   complexed with ca, k; mutant

Details for d7lj5d2

PDB Entry: 7lj5, 2.26 Å

PDB Description: human traak k+ channel fhieg mutant a198e in a k+ bound conductive conformation

PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d7lj5d2:

Sequence; same for both SEQRES and ATOM records:

>d7lj5d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d7lj5d2:

• d7lj5d2 is new in SCOPe 2.07-stable
  
• d7lj5d2 appears in the current release, SCOPe 2.08