Lineage for d7aweg_ (7awe G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990749Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)
  8. 2990766Domain d7aweg_: 7awe G: [404742]
    Other proteins in same PDB: d7aweb_, d7awec_, d7awed_, d7awee_, d7aweh_, d7awei_, d7awej_, d7awek_, d7awel_, d7awem_, d7awen_, d7awer_, d7awes_, d7awev_, d7awew_, d7awex_, d7awey_, d7awez_
    automated match to d1irug_
    complexed with na, s5k, scn

Details for d7aweg_

PDB Entry: 7awe (more details), 2.29 Å

PDB Description: human immunoproteasome 20s particle in complex with [(1r)-2-(1- benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2- yl]formamido}ethyl]boronic acid
PDB Compounds: (G:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d7aweg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aweg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
gtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsn
krlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhayt
lysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmke
mtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakesl
ke

SCOPe Domain Coordinates for d7aweg_:

Click to download the PDB-style file with coordinates for d7aweg_.
(The format of our PDB-style files is described here.)

Timeline for d7aweg_: