SCOPe 2.08: Domain d7aweu_: 7awe U:

Lineage for d7aweu_ (7awe U:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)

8. Domain d7aweu_: 7awe U: [404410]
   Other proteins in same PDB: d7aweb_, d7awec_, d7awed_, d7awee_, d7aweh_, d7awei_, d7awej_, d7awek_, d7awel_, d7awem_, d7awen_, d7awer_, d7awes_, d7awev_, d7awew_, d7awex_, d7awey_, d7awez_
   automated match to d1irug_
   complexed with na, s5k, scn

Details for d7aweu_

PDB Entry: 7awe, 2.29 Å

PDB Description: human immunoproteasome 20s particle in complex with [(1r)-2-(1- benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2- yl]formamido}ethyl]boronic acid

PDB Compounds: (U:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d7aweu_:

Sequence; same for both SEQRES and ATOM records:

>d7aweu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
tgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnk
rlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytl
ysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkem
tcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk

Timeline for d7aweu_:

• d7aweu_ first appeared in SCOPe 2.07