SCOPe 2.08: Domain d7awez_: 7awe Z:

Lineage for d7awez_ (7awe Z:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)

8. Domain d7awez_: 7awe Z: [404414]
   Other proteins in same PDB: d7awea_, d7aweb_, d7awec_, d7awef_, d7aweg_, d7aweh_, d7awej_, d7awem_, d7awen_, d7aweo_, d7awep_, d7awet_, d7aweu_, d7awev_, d7awex_
   automated match to d3unfk_
   complexed with na, s5k, scn

Details for d7awez_

PDB Entry: 7awe, 2.29 Å

PDB Description: human immunoproteasome 20s particle in complex with [(1r)-2-(1- benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2- yl]formamido}ethyl]boronic acid

PDB Compounds: (Z:) Proteasome subunit beta type-8

SCOPe Domain Sequences for d7awez_:

Sequence; same for both SEQRES and ATOM records:

>d7awez_ d.153.1.4 (Z:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tttlafkfqhgviaavdsrasagsyisalrvnkvieinpyllgtmsgcaadcqywerlla
kecrlyylrngerisvsaaskllsnmmcqyrgmglsmgsmicgwdkkgpglyyvdehgtr
lsgnmfstgsgntyaygvmdsgyrpnlspeeaydlgrraiayathrdsysggvvnmyhmk
edgwvkvestdvsdllhqyrean

Timeline for d7awez_:

• d7awez_ first appeared in SCOPe 2.07