Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d7awek_: 7awe K: [404704] Other proteins in same PDB: d7awea_, d7aweb_, d7awec_, d7awef_, d7aweg_, d7aweh_, d7awej_, d7awem_, d7awen_, d7aweo_, d7awep_, d7awet_, d7aweu_, d7awev_, d7awex_ automated match to d1iruk_ complexed with na, s5k, scn |
PDB Entry: 7awe (more details), 2.29 Å
SCOPe Domain Sequences for d7awek_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7awek_ d.153.1.4 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv riidkngihdldnisf
Timeline for d7awek_: