Lineage for d7cjic_ (7cji c:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634071Protein automated matches [191285] (5 species)
    not a true protein
  7. 2634087Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries)
  8. 2634109Domain d7cjic_: 7cji c: [403160]
    Other proteins in same PDB: d7cjia_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
    automated match to d5b66c_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjic_

PDB Entry: 7cji (more details), 2.35 Å

PDB Description: photosystem ii structure in the s1 state
PDB Compounds: (c:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d7cjic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjic_ f.55.1.1 (c:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
nsifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipe
kpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpe
tleeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrv
itnptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfg
warrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtfl
irdqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldln
kikndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlafffl
vghlwhagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d7cjic_:

Click to download the PDB-style file with coordinates for d7cjic_.
(The format of our PDB-style files is described here.)

Timeline for d7cjic_: