| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
| Family f.23.40.1: PsbX-like [267615] (2 proteins) |
| Protein automated matches [267680] (2 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
| Domain d7cjix_: 7cji x: [403201] Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjiz_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cji (more details), 2.35 Å
SCOPe Domain Sequences for d7cjix_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjix_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d7cjix_: