Lineage for d7cjit_ (7cji t:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631879Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2631880Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 2631881Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2631896Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries)
  8. 2631904Domain d7cjit_: 7cji t: [403476]
    Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
    automated match to d2axtt1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjit_

PDB Entry: 7cji (more details), 2.35 Å

PDB Description: photosystem ii structure in the s1 state
PDB Compounds: (t:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d7cjit_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjit_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d7cjit_:

Click to download the PDB-style file with coordinates for d7cjit_.
(The format of our PDB-style files is described here.)

Timeline for d7cjit_: