![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (14 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries) |
![]() | Domain d7cjid_: 7cji D: [403159] Other proteins in same PDB: d7cjib_, d7cjic_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_ automated match to d5zznd_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cji (more details), 2.35 Å
SCOPe Domain Sequences for d7cjid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjid_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe fetfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d7cjid_: