![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
![]() | Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
![]() | Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries) |
![]() | Domain d7cjif_: 7cji f: [403315] Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_ automated match to d3a0hf_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cji (more details), 2.35 Å
SCOPe Domain Sequences for d7cjif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjif_ f.23.38.1 (f:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]} iftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d7cjif_: