![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
![]() | Domain d7cjiu_: 7cji U: [403178] Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiv_, d7cjix_, d7cjiz_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cji (more details), 2.35 Å
SCOPe Domain Sequences for d7cjiu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjiu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt erqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d7cjiu_: