SCOPe 2.08: Domain d6t3jg2: 6t3j G:107-213

Lineage for d6t3jg2 (6t3j G:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6t3jg2: 6t3j G:107-213 [391753]
   Other proteins in same PDB: d6t3ja_, d6t3jb1, d6t3jc_, d6t3jd1, d6t3je1, d6t3je2, d6t3je3, d6t3jf_, d6t3jg1, d6t3jh_, d6t3ji1, d6t3jj1, d6t3jj2, d6t3jj3
   automated match to d1dn0a2

Details for d6t3jg2

PDB Entry: 6t3j, 3.05 Å

PDB Description: dual epitope targeting by anti-dr5 antibodies

PDB Compounds: (G:) IgG1-hDR5-01-Light Chain

SCOPe Domain Sequences for d6t3jg2:

Sequence; same for both SEQRES and ATOM records:

>d6t3jg2 b.1.1.2 (G:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6t3jg2:

• d6t3jg2 first appeared in SCOPe 2.07