Lineage for d6t3ja_ (6t3j A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758252Domain d6t3ja_: 6t3j A: [411838]
    Other proteins in same PDB: d6t3jb2, d6t3jd2, d6t3je1, d6t3je2, d6t3je3, d6t3jg2, d6t3ji2, d6t3jj1, d6t3jj2, d6t3jj3
    automated match to d6shgh_

Details for d6t3ja_

PDB Entry: 6t3j (more details), 3.05 Å

PDB Description: dual epitope targeting by anti-dr5 antibodies
PDB Compounds: (A:) IgG1-hDR5-01-Heavy Chain

SCOPe Domain Sequences for d6t3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t3ja_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqsgaevvkpgasvklsckasgfnikdtfihwvkqapgqglewigridpantntky
dpkfqgkatittdtssntaymelsslrsedtavyycvrglytyyfdywgqgtlvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

SCOPe Domain Coordinates for d6t3ja_:

Click to download the PDB-style file with coordinates for d6t3ja_.
(The format of our PDB-style files is described here.)

Timeline for d6t3ja_:

  • d6t3ja_ is new in SCOPe 2.08-stable