Lineage for d7cmdc1 (7cmd C:1-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933522Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries)
  8. 2933559Domain d7cmdc1: 7cmd C:1-61 [390096]
    Other proteins in same PDB: d7cmda2, d7cmda3, d7cmdb2, d7cmdb3, d7cmdc2, d7cmdc3, d7cmdd2, d7cmdd3
    automated match to d4m0wa1
    complexed with ttt, zn

Details for d7cmdc1

PDB Entry: 7cmd (more details), 2.59 Å

PDB Description: crystal structure of the sars-cov-2 plpro with grl0617
PDB Compounds: (C:) non-structural protein 3

SCOPe Domain Sequences for d7cmdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cmdc1 d.15.1.0 (C:1-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn
d

SCOPe Domain Coordinates for d7cmdc1:

Click to download the PDB-style file with coordinates for d7cmdc1.
(The format of our PDB-style files is described here.)

Timeline for d7cmdc1: