SCOPe 2.08: Domain d6z2mc2: 6z2m C:113-219

Lineage for d6z2mc2 (6z2m C:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6z2mc2: 6z2m C:113-219 [387083]
   Other proteins in same PDB: d6z2ma_, d6z2mb_, d6z2mc1, d6z2md_, d6z2me_, d6z2mf_, d6z2mh_, d6z2ml1
   automated match to d5kw9l2
   complexed with nag

Details for d6z2mc2

PDB Entry: 6z2m, 2.71 Å

PDB Description: h11-d4, sars-cov-2 rbd, cr3022 ternary complex

PDB Compounds: (C:) CR3022 antibody

SCOPe Domain Sequences for d6z2mc2:

Sequence; same for both SEQRES and ATOM records:

>d6z2mc2 b.1.1.2 (C:113-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6z2mc2:

• d6z2mc2 first appeared in SCOPe 2.07