Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6z2ml1: 6z2m L:1-112 [387054] Other proteins in same PDB: d6z2ma_, d6z2mc2, d6z2md_, d6z2me_, d6z2mf_, d6z2ml2 automated match to d5kw9l1 complexed with nag |
PDB Entry: 6z2m (more details), 2.71 Å
SCOPe Domain Sequences for d6z2ml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z2ml1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqltqspdslavslgeratinckssqsvlyssinknylawyqqkpgqppklliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpytfgqgtkvei
Timeline for d6z2ml1: