Lineage for d6z2ml1 (6z2m L:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757437Domain d6z2ml1: 6z2m L:1-112 [387054]
    Other proteins in same PDB: d6z2ma_, d6z2mc2, d6z2md_, d6z2me_, d6z2mf_, d6z2ml2
    automated match to d5kw9l1
    complexed with nag

Details for d6z2ml1

PDB Entry: 6z2m (more details), 2.71 Å

PDB Description: h11-d4, sars-cov-2 rbd, cr3022 ternary complex
PDB Compounds: (L:) CR3022 antibody

SCOPe Domain Sequences for d6z2ml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z2ml1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspdslavslgeratinckssqsvlyssinknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpytfgqgtkvei

SCOPe Domain Coordinates for d6z2ml1:

Click to download the PDB-style file with coordinates for d6z2ml1.
(The format of our PDB-style files is described here.)

Timeline for d6z2ml1: