SCOP 1.67: Domain d1fytb2: 1fyt B:3-92

Lineage for d1fytb2 (1fyt B:3-92)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)

8. Domain d1fytb2: 1fyt B:3-92 [38170]
   Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytd1, d1fytd2, d1fyte1, d1fyte2
   complexed with nag; mutant

Details for d1fytb2

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytb2:

Sequence; same for both SEQRES and ATOM records:

>d1fytb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1fytb2:

• d1fytb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fytb2 appears in SCOP 1.65
  
• d1fytb2 appears in SCOP 1.69
  
• d1fytb2 appears in the current release, SCOPe 2.08