Lineage for d1fyta1 (1fyt A:82-181)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364815Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries)
    probably orthologous to the mouse I-E group
  8. 364835Domain d1fyta1: 1fyt A:82-181 [21595]
    Other proteins in same PDB: d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2
    complexed with nag; mutant

Details for d1fyta1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyta1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1fyta1:

Click to download the PDB-style file with coordinates for d1fyta1.
(The format of our PDB-style files is described here.)

Timeline for d1fyta1: