Lineage for d1fyte2 (1fyt E:119-246)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366220Protein T-cell antigen receptor [49125] (6 species)
  7. 366231Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries)
  8. 366236Domain d1fyte2: 1fyt E:119-246 [21573]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1
    complexed with nag; mutant

Details for d1fyte2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyte2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOP Domain Coordinates for d1fyte2:

Click to download the PDB-style file with coordinates for d1fyte2.
(The format of our PDB-style files is described here.)

Timeline for d1fyte2: