![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries) |
![]() | Domain d1fytb2: 1fyt B:3-92 [38170] Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytd1, d1fytd2, d1fyte1, d1fyte2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1fyt (more details), 2.6 Å
SCOPe Domain Sequences for d1fytb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fytb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn sqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1fytb2: