SCOP 1.67: Domain d1fytd1: 1fyt D:1-117

Lineage for d1fytd1 (1fyt D:1-117)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries)

8. Domain d1fytd1: 1fyt D:1-117 [20621]
   Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2
   complexed with nag; mutant

Details for d1fytd1

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytd1:

Sequence; same for both SEQRES and ATOM records:

>d1fytd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

Timeline for d1fytd1:

• d1fytd1 first appeared (with stable ids) in SCOP 1.55
  
• d1fytd1 appears in SCOP 1.65
  
• d1fytd1 appears in SCOP 1.69
  
• d1fytd1 appears in the current release, SCOPe 2.08