SCOP 1.67: Domain d1fyta2: 1fyt A:2-81

Lineage for d1fyta2 (1fyt A:2-81)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (11 PDB entries)
Domain d1fyta2: 1fyt A:2-81 [38169]
Other proteins in same PDB: d1fyta1, d1fytb1, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2
complexed with nag; mutant

Details for d1fyta2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyta2 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

SCOP Domain Coordinates for d1fyta2:

Click to download the PDB-style file with coordinates for d1fyta2.
(The format of our PDB-style files is described here.)

Timeline for d1fyta2: