Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries) |
Domain d6jlnj_: 6jln j: [375458] Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jln (more details), 2.4 Å
SCOPe Domain Sequences for d6jlnj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlnj_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mseggriplwivatvagmgvivivglffygayaglgssl
Timeline for d6jlnj_: