Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries) |
Domain d6jlnd_: 6jln d: [375438] Other proteins in same PDB: d6jlnb_, d6jlnc_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_ automated match to d5zznd_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jln (more details), 2.4 Å
SCOPe Domain Sequences for d6jlnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlnd_ f.26.1.1 (d:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef etfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d6jlnd_: