Lineage for d6jlnf_ (6jln f:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026778Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)
  7. 3026785Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)
  8. 3026794Domain d6jlnf_: 6jln f: [375437]
    Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_
    automated match to d3a0hf_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnf_

PDB Entry: 6jln (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d6jlnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlnf_ f.23.38.1 (f:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
piftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d6jlnf_:

Click to download the PDB-style file with coordinates for d6jlnf_.
(The format of our PDB-style files is described here.)

Timeline for d6jlnf_: