Lineage for d6jlnx_ (6jln X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026852Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 3026853Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 3026857Protein automated matches [267680] (2 species)
    not a true protein
  7. 3026871Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)
  8. 3026893Domain d6jlnx_: 6jln X: [375478]
    Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnz_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnx_

PDB Entry: 6jln (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d6jlnx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlnx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqrs

SCOPe Domain Coordinates for d6jlnx_:

Click to download the PDB-style file with coordinates for d6jlnx_.
(The format of our PDB-style files is described here.)

Timeline for d6jlnx_: